Words Containing: S,N,A,T,C,H
(In Any Order)
There are 1,751 words,
2,280 phrases and
0 abbr's with
S,N,A,T,C,H in.
Best Scoring Words With: S,N,A,T,C,H
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | snatchy | 7 | 15 | adjectiveadj | |||
2 | staunch | 7 | 12 | adjectiveadj | |||
3 | canthus | 7 | 12 | nounn | |||
4 | chasten | 7 | 12 | verbv | |||
5 | chaunts | 7 | 12 | verbv | |||
6 | acanths | 7 | 12 | nounn | |||
7 | chatons | 7 | 12 | nounn | |||
8 | natches | 7 | 12 | ||||
9 | snatch | 6 | 11 | verb, nounv, n | |||
10 | stanch | 6 | 11 | verbv | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (34)
snatcher13scathing14scythianacanthus13unchaste13asthenic13stanchly16snatched14snatches13chantors13enchants13chastens13stanched14chitosan13stanches13tranches13nautches13chanters13etchants13chanteys16chanties13tachyons16jacinths20manchets15stancher13chiantis13tulchans13acanthas13snapchatstanchel13trashcan13unstarch13eschatonschantze22Phrases (3)
snatch upcorn tashtrash canWords (108)
christian14anarchist14unscathed15macintosh16scotchmanyachtsman19machinist16sycophant19hesitancy17astrachan14stanchion14staunchly17chanteuse14hesitance14hanseatic14acanthous14cenotaphs16merchants16pentarchs16snatchers14handcarts15starching15bacchants18mechanist16yachtsmen19chantages15planchets16chastened15chastener14unlatches14stanching15anchorets14teachings15penchants16ethnarchs17
...View all with 9 letters...
Phrases (5)
ernst machcashew nutskin patchchest painchin strapWords (161)
manchester17scratching18anesthetic15antichrist15charleston15chauvinist18scathingly19pocahontashumanistic17crankshaft22monarchist17mackintosh21chastising16cornstarch17chasteness15chastening16disenchant16charlatans15handcrafts19encashment17phantasmic19machinists17chieftains18patchiness17chanteuses15catchments19anarchists15mechanists17chasteners15unchastity18sycophants20raunchiest15hesitances15branchiest17branchlets17
...View all with 10 letters...
Phrases (13)
stand watchchain storechain tongsghost danceswitch canest. nicholaslancet fishfinish coatgenus cathacast anchor
...View all with 10 letters...
Words (217)
anaesthetic16charlestownenchantress16deutschlandpantheistic18cholangitisanarchistic18schenectadycarpathiansunchristian16captainship20sycophantic23christiania16shamanistic18unaesthetic16mechanistic20esthetician16harmonicist18anthracites16cohabitants18dispatching20cachinnates18charmingest19starchiness16machinators18technicians18technocrats18myasthenics21anesthetics16disenchants17catechising19beachfronts21preachments20attachments18avouchments21
...View all with 11 letters...
Phrases (35)
sheet anchorgenus achetatennis coachstate changesection handcanis anthusseat cushionethics panelchange statescratch line
...View all with 11 letters...
Words (240)
christianityenthusiastic17chauvinistic22encephalitis19calisthenics19happenstance21anaesthetics17disenchanted19saskatchewanstenographic20gemeinschaft23shortchanged22neurasthenic17watchfulness23charlatanism19chastisement19misanthropic21aesthetician17stickhandled23stickhandles22photoscanned20schematizing29impeachments23unhysterical20hallucinates17machinations19detachedness19inchoateness17chanticleers19enchantments19leathernecks21chiropterans19transhumance19enhancements19chastenesses17
...View all with 12 letters...
Phrases (71)
captain hicksstephen cranehandling costman's clothingernst haeckelgenus tarichaanimal starchhunter's saucehernan cortessnellen chart
...View all with 12 letters...
Words (254)
psychoanalyst26craftsmanship25chrysanthemum28laughingstock24orchestrating19unsympathetic25antipsychotic25anachronistic20custodianship21transthoracic20thoracentesis18orchestration18synthetically24terpsichorean20disenchanting20shortchanging23christianized28autochthonous21chieftainship26containership20phagocytosing25crosshatching24photoscanning21theoreticians18analphabetics22charlatanisms20accouchements24handcraftsman24handcraftsmen24pantechnicons22schismatizing30nonarchitects20authenticates18vouchsafement26technobabbles24
...View all with 13 letters...
Phrases (102)
dwarf chestnutfrances wrightsandwich platemachine stitchii corinthiansplanter's punchgenus acanthussunday clothesmonastic habitwater chestnut
...View all with 13 letters...
Words (287)
accomplishment27sophistication21apprenticeship25thermodynamics27cholinesterase19psychoanalytic29schoolteaching25narcosynthesis22unenthusiastic19disenchantment22characterising22disinheritance20architectonics23methodicalness22monochromatism25antiphlogistic22lithifications22countercharges22machicolations23canthaxanthins29handicraftsman25handicraftsmen25bronchiectases23technicalities21inchoatenesses19cinematographs24metaphysicians26antihistaminic21authenticators19authenticities19rapprochements25nonattachments21mathematicians23blacksmithings28hedonistically23
...View all with 14 letters...
Phrases (111)
theodor schwannbreathing spacecastle in the airchanson de gestegaston lachaisestephen leacockbristol channelchinese lanternbritish cabinetmale chauvinist
...View all with 14 letters...
Words (206)
synchronization32pithecanthropus27unsophisticated23interscholastic22synchronisation23enfranchisement25plainclothesman24neuropsychiatry28kinesthetically27coldheartedness22phosphocreatine27accomplishments28treacherousness20echinodermatous23nonachievements25schematizations31trisoctahedrons21bronchodilators23antiaphrodisiac23authentications20antihistaminics22disenchantingly25transhistorical20psychohistorian28sycophantically30psychometrician29cyproheptadines28weltanschauungs24anticholesterol20autochthonously26orchestrational20cholinesterases20apprenticeships26reorchestrating21reorchestration20
...View all with 15 letters...
Phrases (158)
italian sandwichathletic contestgenus anthocerosacross the nationernst boris chainmerchant vesselsmythical monsteranesthetic agentchromatic visiontragulus kanchil
...View all with 15 letters...
Words (90)
enthusiasticallypsychoanalyticaluncharacteristiccharacterisationoverenthusiasticacquaintanceshipneuropsychiatricantistrophicallyantitechnologiesthermoremanenceschristianisationfarfetchednessespostencephaliticchristianizationnonpsychiatristsarchaeoastronomythyrocalcitoninsarchconservativemonotheisticallyfeatherstitchingphantasmagoricalunsophisticationanthropocentrismstenographicallyuntouchabilitiesstereophonicallycyanoethylationshippocastanaceaemachineabilitiespharmacogeneticskinaestheticallypharmacokineticslymphangiectasialymphangiectasisfrenchifications
...View all with 16 letters...
Phrases (182)
manihot esculentachristian huygenscaptain john smithochotona princepsgenus crotaphytuschain of mountainsacross the countrysir richard burtonjohn scott haldanetendon of achilles
...View all with 16 letters...
Words (51)
nonmathematiciansantischizophreniaantischizophrenicleukoencephalitisdisfranchisementsthrombocytopeniascrashworthinessesarchconservativesunsophisticationsencephalomyelitiscontradistinguishstraightjacketingbacteriorhodopsinpharmacognosticaltransthoracicallydehumidificationstreacherousnessesacquaintanceshipsbiomathematiciansmechanoreceptionsneuropsychiatriesneuropsychiatristmerchantabilitieshandcraftsmanshipunsympatheticallyphotocoagulationsdesynchronisationdesynchronizationphotodissociatingphotodissociationphotoduplicationsanthropocentrismsanachronisticallyhexachloroethanesphotojournalistic
...View all with 17 letters...
Phrases (208)
horizontal sectionacherontia atropossubphylum craniatabureau of the censusantipsychotic drugorder ornithischiacalycanthus familytrichechus manatusanas platyrhynchospython reticulatus
...View all with 17 letters...
Words (26)
disenfranchisementmonochromaticitiesarchaeoastronomiespentachlorophenolspostpsychoanalyticaustralopithecinesbacteriorhodopsinscharacteristicnessdehydrochlorinatesmechanochemistriesaerothermodynamicsneuropsychiatristshandcraftsmanshipsanticholinesterasephotodissociationsphotoreactivationspseudoparenchymatachlortetracyclinesuncharitablenessespsychoanalyticallyphotosyntheticallycytoarchitectonicsethnomusicologicalunenthusiasticallyhypernationalistictheatricalizationsPhrases (202)
lachrymal secretiongenus encephalartosantipsychotic agentnational censorshipgenus chamaecytisussphenodon punctatumchemical operationsascension of the lordkamchatka peninsulacrataegus oxycantha
...View all with 18 letters...
Words (27)
disenfranchisementsencephalomeningitisresorcinolphthaleinanarcho-collectivismcytopathogenicitiesimmunohistochemicalphenomenalisticallypseudohallucinationphosphatidylcholinephosphofructokinaseneuropharmacologistcontradistinguishedcontradistinguishesmeningoencephalitismethylcholanthreneselectroretinographsencephalomyelitidesunapproachabilitiesanticholinesterasesphotoreconnaissancediethylcarbamazinesinterchangeablenesshyperconcentrationshypoadrenocorticismphacoemulsificationexhibitionisticallymischaracterizationPhrases (181)
hydrastis canadensisgiles lytton stracheydivision schizophytagenus cryptobranchuscaesalpinia echinatacapital of kazakhstanstephen michael reichcalycanthus floriduschinese monetary unitbritish capacity unit
...View all with 19 letters...
Words (23)
uncharacteristicallyoverenthusiasticallyhyperadrenocorticismphenylthiocarbamidesinterchangeabilitiesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphofructokinasesneuropharmacologistsneuropsychiatricallycontradistinguishingmagnetohydrodynamicshistoincompatibilityanthropocentricitiesencephalomyocarditispseudocholinesterasechlorofluoromethanespseudoparenchymatousphotoreconnaissancespseudosophisticationmischaracterizationsPhrases (168)
photographic emulsiondivision tracheophytastephen butler leacockbalance sheet analysisdianthus caryophyllusislamic calendar monthrepublic of kazakhstanernst heinrich haeckelcantharellus cibariussouth american country
...View all with 20 letters...
Words (9)
interchangeablenessesacetylcholinesteraseselectroencephalogramsadrenocorticotrophinsmeningoencephalitideselectroretinographiespseudocholinesterasespseudosophisticationstetrahydrocannabinolsPhrases (152)
acrocentric chromosomeabelmoschus esculentusfrances hodgson burnetthelianthemum scopariumanaphalis margaritaceaanthriscus cereifoliumphilosophical doctrinetelephone conversationzonotrichia albicollistransmission mechanism
...View all with 21 letters...
Words (2)
electroencephalographsencephalomyocarditisesPhrases (146)
schlumbergera truncatusherbert marshall mcluhanviola tricolor hortensisteacher-student relationfrancis richard stocktoncapital of liechtensteinrhythm and blues musicianpartnership certificateivan sergeevich turgenevcharacter assassination
...View all with 22 letters...
Words (4)
laryngotracheobronchitiselectroencephalographerselectroencephalographiesdichlorodifluoromethanesPhrases (75)
trip the light fantastic toearthur meier schlesinger jr.commonwealth of the bahamasgioacchino antonio rossinirichard buckminster fullertechnology administrationcomprehensive examinationfranz seraph peter schuberthypersensitivity reactioncharles augustus lindbergh
...View all with 24 letters...
Phrases (79)
igor fyodorovich stravinskymary wollstonecraft shelleybattle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentdistinguished service medalboris leonidovich pasternakrudolf christian karl dieselwar of the spanish successionmelanerpes erythrocephalus
...View all with 25 letters...
Phrases (56)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkbattle of monmouth court housefrances eliza hodgson burnettshort-spurred fragrant orchidbacon-lettuce-tomato sandwichhunting and gathering societywar of the austrian successionanton grigorevich rubinstein
...View all with 26 letters...
Phrases (30)
nikita sergeyevich khrushchevelectromechanical transducerdirector-stockholder relationjerusalem artichoke sunflowercryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic processhyacinthus orientalis albulusthrough empirical observation
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (38)
marcus junius brutus the youngerdistinguishing characteristiccommission on the status of womenthird council of constantinoplejohan julius christian sibeliusdepartment of homeland securitygrace ethel cecile rosalie allensergei mikhailovich eisensteincongregation of the inquisitiondissident irish republican army
...View all with 28 letters...
Phrases (24)
chemical decomposition reactiondisorganized type schizophreniasouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unitcongregational christian churchhydrangea macrophylla hortensisconstitution of the united statessecond epistle to the corinthiansgeorges joseph christian simenon
...View all with 29 letters...
Phrases (16)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencejacques anatole francois thibaultaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedentmucocutaneous lymph node syndrometechnical analysis of stock trends
...View all with 30 letters...
Phrases (19)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansdigital communications technologyfrances elizabeth caroline willardchickasaw national recreation areaanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wildefrancoise-athenais de rochechouart
...View all with 31 letters...
Phrases (10)
hierarchical classification systemsergei aleksandrovich koussevitzkystraight-line method of depreciationtheory of electrolytic dissociationedmond louis antoine huot de goncourtoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosischrysanthemum coronarium spatiosumamaranthus hybridus erythrostachysPhrases (16)
breach of trust with fraudulent intentbureau of alcohol tobacco and firearmselizabeth cleghorn stevenson gaskellsir winston leonard spenser churchillright to speedy and public trial by jurykonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (13)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusmassachusetts institute of technologydepartment of health and human servicesassociation of southeast asian nationsbaron hugh caswall tremenheere dowding
...View all with 34 letters...
Phrases (8)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadetransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorunited states naval research laboratoryPhrases (9)
secretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmentalbert francis charles augustus emmanuelsecretary of health education and welfarealbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberPhrases (6)
national oceanic and atmospheric administrationcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniainternational society for krishna consciousnessPhrases (6)
nineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundunited society of believers in christ's second appearing